PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G28210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 229aa    MW: 25094.5 Da    PI: 8.8657
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G28210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.11.5e-1878131356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+ +++keq + Lee F+ n++++ +++e LA kl+L  rqV vWFqNrRa+ k
  OGLUM01G28210.1  78 KKLRLSKEQSRLLEESFRLNHTLTPKQKEALAIKLKLRPRQVEVWFQNRRARTK 131
                      67789***********************************************98 PP

2HD-ZIP_I/II121.15.8e-3978165289
      HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                      kk+rlskeq++lLEesF+ +++L+p++K++la +L+l+prqv+vWFqnrRARtk+kq+E+++e+Lkr++ +l+een+rL++eveeLr+
  OGLUM01G28210.1  78 KKLRLSKEQSRLLEESFRLNHTLTPKQKEALAIKLKLRPRQVEVWFQNRRARTKLKQTEMECEYLKRCFGSLTEENRRLQREVEELRA 165
                      9*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-1748134IPR009057Homeodomain-like
SuperFamilySSF466892.88E-1963134IPR009057Homeodomain-like
PROSITE profilePS5007116.84473133IPR001356Homeobox domain
SMARTSM003891.2E-1575137IPR001356Homeobox domain
CDDcd000861.22E-1476134No hitNo description
PfamPF000469.2E-1678131IPR001356Homeobox domain
PROSITE patternPS000270108131IPR017970Homeobox, conserved site
SMARTSM003407.1E-23133176IPR003106Leucine zipper, homeobox-associated
PfamPF021833.3E-10133166IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MGATSPSGLE LTMAVPGLSS SSGSEGAGCN NNNAGGGCNM RDLDINQPAS GGEEEEFPMG  60
SVEEDEEERG VGGPHRPKKL RLSKEQSRLL EESFRLNHTL TPKQKEALAI KLKLRPRQVE  120
VWFQNRRART KLKQTEMECE YLKRCFGSLT EENRRLQREV EELRAMRVAP PTVLSPHTRQ  180
PLPASALTMC PRCERITAAT GPPAVRPPPS SAAAAAPSLF HPRRPSAAF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125133RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1457270.0AF145727.1 Oryza sativa homeodomain leucine zipper protein (Oshox3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645561.11e-138PREDICTED: homeobox-leucine zipper protein HOX3
SwissprotQ0JKX11e-140HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH381e-140HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A0D9YCC01e-166A0A0D9YCC0_9ORYZ; Uncharacterized protein
STRINGORGLA01G0196200.11e-164(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP68263549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.17e-60homeobox-leucine zipper protein 17